Dataset for protein Bad of organism Sus scrofa

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A287AEF3_BAD-02 BCL2-associated agonist of cell death protein OS=[Eukaryota] Sus scrofa GN=BAD (length=117 residues).
MFQIPEFEQSEQEDSSPADRGLGPSPTGTDPQAPASPGARPQATWGKLVTSRGSRPAAATMEALGLWRPGVATALTQRGP
RRMKGLRMRSSAPSAADRSRRPPSSGLHSVMAASSGG
>gnl|bcl2dbpro|A0A287AEF3_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Sus scrofa GN=BAD (length=208 residues).
MGIPENPSSASTHTQGIRKSGAEPGTPEEGGGRGRSRSGPASQSMFQIPEFEQSEQEDSSPADRGLGPSPTGTDPQPWRT
APGHLGEAGHQQGQPASSSHHGGAGAVETRSRHSSYPEGTEEDEGTEDEELSPFRGRSLSAPPILWAAQRYGRELRRMSD
EFQGSFKGLPRPKSAGTATQMRQSPSWKRFLQSWWYRNSGRGGPAPSQ
© 1998-2018