Dataset for protein Unclassified of organism Stegastes partitus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A3B5B3B7_uncBCL2L11-01 Putative BCL2-like 11 protein OS=[Eukaryota] Stegastes partitus (length=221 residues).
SDESPGSRCPTEGSGADPEPAGAAGASAQKSRSNEERSVGQRSSAGGEPDSPPWCPASLGVFQTRSIFHLPRRSSSGYFS
ADGADSVPSSPLFLKRLTADKATQTRSPSGQVIEHAMGRMADEAHEAVGRALRRIGDDYDRILMVRVRDGQCLCVCVSEE
GCGHRQQPPADTFVQMLTKVLKTAVEQLFCQILLYFIFFFIMVGYLSSSNVKPHVETGGVK
© 1998-2019