Dataset for protein classical BH3-containing proteins of organism Stegastes partitus

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A3B5B8F6_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Stegastes partitus GN=BMF (length=164 residues).
MDDEEDDVFEPDPHCWRTTFREIKCEDRGTQTPGPALQPNNGMLPCGVAEEPRPLFYGNAGFRLHFPARFELIGDHQARQ
QQGSEMEQNGMEQLPRQQPVARSVEACIGQKLQLIGDQFHREHLQLYHRNQRNQGPLWWRLAAALLSLLFDRGFIAGGGG
AGRR
>gnl|bcl2dbpro|A0A3B5BAL2_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Stegastes partitus GN=BAD (length=166 residues).
MAAQFSISGSESDPEEVEEGENNHPPAEQPMHVFERRNLALPELRTPAAGRIRLNSESHATTVSRDEELQARGEEEAGTP
TDGAPFRGRSKSAPPALWAAKKYGQKLRRMSDEFDSLLDKGEMKRVRSAGTAKQMHHSKSWWSYLFSHQELEGENNHHEN
HTHRNE
© 1998-2019