Dataset for protein Bmf of organism Stegastes partitus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A3B5B8F6_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Stegastes partitus GN=BMF (length=164 residues).
MDDEEDDVFEPDPHCWRTTFREIKCEDRGTQTPGPALQPNNGMLPCGVAEEPRPLFYGNAGFRLHFPARFELIGDHQARQ
QQGSEMEQNGMEQLPRQQPVARSVEACIGQKLQLIGDQFHREHLQLYHRNQRNQGPLWWRLAAALLSLLFDRGFIAGGGG
AGRR
© 1998-2019