Dataset for protein classical BH3-containing proteins of organism Seriola lalandi dorsalis

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A3B4W9T1_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Seriola lalandi dorsalis GN=BAD (length=167 residues).
MAANFTISDSESEPSEEVDEGEMSQSLTGQEQELSQRHTLTLPELRGAATGRTRLNSESHTSTVSRDEEFQARGEEEAGT
PTEGAPFRGRSKSAPPALWAAKKYGQKLRRMSDEFDSLLDKGEMRKVKSAGTAKQMHHSKSWWSYLFSHQETEGENNHHE
NHTHRTE
>gnl|bcl2dbpro|A0A3B4WM88_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Seriola lalandi dorsalis GN=BMF (length=163 residues).
MDDEEDDVFEPDPHCWRTTFREIKCEDRGTQTPGPALALNNGMLPCGVAKEPRPLFYGNAGFRLHFPAHFELVGDQEARR
QGSGEERNGMEQLPRQQPVARSVEACIGQKLQLIGDQFHREHLQLYHQNQRNHGPLWWRLAAALLSLLFDRGLIAGGGGA
GRR
>gnl|bcl2dbpro|A0A3B4XZH1_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Seriola lalandi dorsalis GN=BCL2L11 (length=216 residues).
MKAQADGAALFIQQTTKPVRWLDRSNGKRGERRGSTTRRCRWSPGAKPQFERQRRAETIATSPGNSLGVFQKRSIFSYPR
RSSSGYFSFDSDSLPTSPLSPRPATAERTTQTPSPTSQVMKHALQRMAEAHGGGARMQQQQHGEHRHFASGDMQAEAVGQ
ELRRIGDDFNRLLLLRVSHHRWCVCVCVCVCACGCVCACGCVCGCVRVCGGGGGVE
© 1998-2019