Dataset for protein Bim of organism Seriola lalandi dorsalis

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A3B4XZH1_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Seriola lalandi dorsalis GN=BCL2L11 (length=216 residues).
MKAQADGAALFIQQTTKPVRWLDRSNGKRGERRGSTTRRCRWSPGAKPQFERQRRAETIATSPGNSLGVFQKRSIFSYPR
RSSSGYFSFDSDSLPTSPLSPRPATAERTTQTPSPTSQVMKHALQRMAEAHGGGARMQQQQHGEHRHFASGDMQAEAVGQ
ELRRIGDDFNRLLLLRVSHHRWCVCVCVCVCACGCVCACGCVCGCVRVCGGGGGVE
© 1998-2019