Dataset for protein classical BH3-containing proteins of organism Seriola dumerili

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|A0A3B4U5H8_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Seriola dumerili GN=BMF (length=163 residues).
MDDEEDDVFEPDPHCWRTTFREIKCEDRGTQTPGPALALNNGMLPCGVAKEPRPLFYGNAGFRLHFPAHFELVGDQEARR
QGSGEERNGMEQLPRQQPVARSVEACIGQKLQLIGDQFHREHLQLYHQNQRNQGPLWWRLAVALLSLLFDRGLIAGGGGA
GRR
>gnl|bcl2dbpro|A0A3B4UNJ0_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Seriola dumerili GN=BMF (length=139 residues).
MDDEEEDMSQPISHLWGTSFRDVKYEDRATPIAAGQALTAVTAAPLILFVWWVPHWELSPSTKMNMLRFSENRPEEQAGV
SVEAQIGRKLREIGDKFQQDHFMRHQRQNLPAWMRLTMALFGFLFPRQALVPRLRGEQR
>gnl|bcl2dbpro|A0A3B4V919_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Seriola dumerili GN=BCL2L11 (length=172 residues).
MKAQADGAALFIQQTTKPVRWLDRSNGKRGERRGSTTRRCRWSPSAKPQFERQRRAEPWPPRLHRRRRARLAAPVQNHSH
LSCQHFSRRSSSGYFSFDSDSLPSSPLSPRPATVERTTQTPSPTSQVMKHALQRMAEAHGGGARMQQQHGELKPALLKHT
KMTSQCCQTHFC
>gnl|bcl2dbpro|A0A3B4VFC5_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Seriola dumerili GN=BAD (length=167 residues).
MAANFTISDSESEPSEEVDEGEMSQSLTGQEQELSQRHTLTLPELRGAATGRTRLNSESHTSTVSRDEEFQARGEEEAGT
PTEGAPFRGRSKSAPPALWAAKKYGQKLRRMSDEFDSLLDKGEMRKVKSAGTAKQMHHSKSWWSYLFSHQETEGENNHHE
NHTHRTE
© 1998-2019