Dataset for protein Bmf of organism Seriola dumerili

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A3B4U5H8_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Seriola dumerili GN=BMF (length=163 residues).
MDDEEDDVFEPDPHCWRTTFREIKCEDRGTQTPGPALALNNGMLPCGVAKEPRPLFYGNAGFRLHFPAHFELVGDQEARR
QGSGEERNGMEQLPRQQPVARSVEACIGQKLQLIGDQFHREHLQLYHQNQRNQGPLWWRLAVALLSLLFDRGLIAGGGGA
GRR
>gnl|bcl2dbpro|A0A3B4UNJ0_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Seriola dumerili GN=BMF (length=139 residues).
MDDEEEDMSQPISHLWGTSFRDVKYEDRATPIAAGQALTAVTAAPLILFVWWVPHWELSPSTKMNMLRFSENRPEEQAGV
SVEAQIGRKLREIGDKFQQDHFMRHQRQNLPAWMRLTMALFGFLFPRQALVPRLRGEQR
© 1998-2019