Dataset for protein Bim of organism Seriola dumerili

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A3B4V919_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Seriola dumerili GN=BCL2L11 (length=172 residues).
MKAQADGAALFIQQTTKPVRWLDRSNGKRGERRGSTTRRCRWSPSAKPQFERQRRAEPWPPRLHRRRRARLAAPVQNHSH
LSCQHFSRRSSSGYFSFDSDSLPSSPLSPRPATVERTTQTPSPTSQVMKHALQRMAEAHGGGARMQQQHGELKPALLKHT
KMTSQCCQTHFC
© 1998-2019