Dataset for protein Bad of organism Seriola dumerili

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A3B4VFC5_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Seriola dumerili GN=BAD (length=167 residues).
MAANFTISDSESEPSEEVDEGEMSQSLTGQEQELSQRHTLTLPELRGAATGRTRLNSESHTSTVSRDEEFQARGEEEAGT
PTEGAPFRGRSKSAPPALWAAKKYGQKLRRMSDEFDSLLDKGEMRKVKSAGTAKQMHHSKSWWSYLFSHQETEGENNHHE
NHTHRTE
© 1998-2019