Dataset for protein classical BH3-containing proteins of organism Scophthalmus maximus

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A2U9BAC9_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Scophthalmus maximus GN=BAD (length=167 residues).
MAANFTISDSESEPSEEVEEGEVSQPWTGPGEQVPPRHTLALPELRMAATGRIRLNSESNASTLSRDEELLTRWDEEAGT
PTDGAPFRGRSKSAPPALWAAMKYGQKLRRMSDEFDSLLDKGEMRKVKSAGTARQMHHSQSWWSYLFSHQEMEGENNHHE
NHTQRNE
>gnl|bcl2dbpro|A0A2U9CJH3_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Scophthalmus maximus GN=BMF (length=217 residues).
MDDEEDDVFEPDPHCWRTTFREIKCEDRGTQTPGPALALNNGMLPCGVAEEPRPLFYGNAGFRLHFPAHFELFGDQEVRG
HESEEERSGMEQLPRQQQPVAHSVEACIGQKLQLIGDQFHREHLQLYHRNQRNQGPLWWRLAAALLSLLFDRGFLAGGGG
AGRRQAHTKRRAKASGPQNRASSVERTVQAMTNQFTSLPPQQLPPPANGRLPCALIG
© 1998-2019