Dataset for protein Bmf of organism Scophthalmus maximus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A2U9CJH3_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Scophthalmus maximus GN=BMF (length=217 residues).
MDDEEDDVFEPDPHCWRTTFREIKCEDRGTQTPGPALALNNGMLPCGVAEEPRPLFYGNAGFRLHFPAHFELFGDQEVRG
HESEEERSGMEQLPRQQQPVAHSVEACIGQKLQLIGDQFHREHLQLYHRNQRNQGPLWWRLAAALLSLLFDRGFLAGGGG
AGRRQAHTKRRAKASGPQNRASSVERTVQAMTNQFTSLPPQQLPPPANGRLPCALIG
© 1998-2019