Dataset for protein Bad of organism Scophthalmus maximus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A2U9BAC9_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Scophthalmus maximus GN=BAD (length=167 residues).
MAANFTISDSESEPSEEVEEGEVSQPWTGPGEQVPPRHTLALPELRMAATGRIRLNSESNASTLSRDEELLTRWDEEAGT
PTDGAPFRGRSKSAPPALWAAMKYGQKLRRMSDEFDSLLDKGEMRKVKSAGTARQMHHSQSWWSYLFSHQEMEGENNHHE
NHTQRNE
© 1998-2019