Dataset for protein classical BH3-containing proteins of organism Sarcophilus harrisii

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|G3VRY4_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Sarcophilus harrisii GN=BAD (length=157 residues).
MFQISEFEPSEPGEDPSASTAPSLAPLRPGPRAAPGAHHHEGAGAGRPRLISYPPLREGSREASPEAEAEAEQSEGEEER
GLFRGRSSSAPPILWAARHYGSELRRMSDEFHCTFKGLPRPKSAGTASQMRRSHGWTRTFQSWFGRNLGKGSVGPSH
>gnl|bcl2dbpro|G3VRY4_BAD-02 BCL2-associated agonist of cell death protein OS=[Eukaryota] Sarcophilus harrisii GN=BAD (length=173 residues).
MFQISEFEPSEPGEDPSASTAPSLAPLRPGPRAAPGAHHHEKGGAQKSQTHVSKELKASASQGRLGKGSFEGREGSREAS
PEAEAEAEQSEGEEERGLFRGRSSSAPPILWAARHYGSELRRMSDEFHCTFKGLPRPKSAGTASQMRRSHGWTRTFQSWF
GRNLGKGSVGPSH
>gnl|bcl2dbpro|G3W979_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Sarcophilus harrisii GN=BCL2L11 (length=200 residues).
MAKQPSDLNSECDREGGQLQPTERPTQPQLRPGAPTSIQTQYQGNSGEGDSCSPSSPQGPFAPPTSPSPFATRSPLFIFV
RRSPLLPRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMDTASMRQSQSIPADMRPEIWIAQELRRIGDEF
NASYPRRGFLDNNYQAADDHHQMVILRLLHYIIRLVWRMQ
>gnl|bcl2dbpro|G3WDQ2_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Sarcophilus harrisii GN=BMF (length=184 residues).
MESPHYVEELEDDVFHPEDSEPGAQPGGLTSPALFAQSQPDYMLDGLQLFPLTHCCGPGLRSVGQEDKATQTLSPASPSQ
GVMLPCGVTEEPHRLFYGNAGYRLPLPANFPSSLRLGAEPPEEQWEHRAEVQIARKLQCIADQFHRLHMQRHQQNQNHVW
WQILLFLHNLALNREENRNGAGPR
© 1998-2018