Dataset for protein Bmf of organism Sarcophilus harrisii

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|G3WDQ2_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Sarcophilus harrisii GN=BMF (length=184 residues).
MESPHYVEELEDDVFHPEDSEPGAQPGGLTSPALFAQSQPDYMLDGLQLFPLTHCCGPGLRSVGQEDKATQTLSPASPSQ
GVMLPCGVTEEPHRLFYGNAGYRLPLPANFPSSLRLGAEPPEEQWEHRAEVQIARKLQCIADQFHRLHMQRHQQNQNHVW
WQILLFLHNLALNREENRNGAGPR
© 1998-2018