Dataset for protein Bim of organism Sarcophilus harrisii

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|G3W979_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Sarcophilus harrisii GN=BCL2L11 (length=200 residues).
MAKQPSDLNSECDREGGQLQPTERPTQPQLRPGAPTSIQTQYQGNSGEGDSCSPSSPQGPFAPPTSPSPFATRSPLFIFV
RRSPLLPRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMDTASMRQSQSIPADMRPEIWIAQELRRIGDEF
NASYPRRGFLDNNYQAADDHHQMVILRLLHYIIRLVWRMQ
© 1998-2018