Dataset for protein Bad of organism Sarcophilus harrisii

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|G3VRY4_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Sarcophilus harrisii GN=BAD (length=157 residues).
MFQISEFEPSEPGEDPSASTAPSLAPLRPGPRAAPGAHHHEGAGAGRPRLISYPPLREGSREASPEAEAEAEQSEGEEER
GLFRGRSSSAPPILWAARHYGSELRRMSDEFHCTFKGLPRPKSAGTASQMRRSHGWTRTFQSWFGRNLGKGSVGPSH
>gnl|bcl2dbpro|G3VRY4_BAD-02 BCL2-associated agonist of cell death protein OS=[Eukaryota] Sarcophilus harrisii GN=BAD (length=173 residues).
MFQISEFEPSEPGEDPSASTAPSLAPLRPGPRAAPGAHHHEKGGAQKSQTHVSKELKASASQGRLGKGSFEGREGSREAS
PEAEAEAEQSEGEEERGLFRGRSSSAPPILWAARHYGSELRRMSDEFHCTFKGLPRPKSAGTASQMRRSHGWTRTFQSWF
GRNLGKGSVGPSH
© 1998-2018