Dataset for protein Noxa of organism Saimiri boliviensis boliviensis

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A2K6S6C4_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Saimiri boliviensis boliviensis GN=PMAIP1 (length=54 residues).
MPGKKARKSAQPSPARAPADLEVECAIQLRRFGDKLNFRQKLLNLISKLFCSGT
© 1998-2018