Dataset for protein classical BH3-containing proteins of organism Saimiri boliviensis boliviensis

[Download (right click)] [Alignment] [Repertoires]

19 sequence(s)

>gnl|bcl2dbpro|A0A2K6S6C4_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Saimiri boliviensis boliviensis GN=PMAIP1 (length=54 residues).
MPGKKARKSAQPSPARAPADLEVECAIQLRRFGDKLNFRQKLLNLISKLFCSGT
>gnl|bcl2dbpro|A0A2K6STD6_BBC3-02 BCL2 binding component 3 protein OS=[Eukaryota] Saimiri boliviensis boliviensis GN=BBC3 (length=131 residues).
MKCGMGSAWACPCQVPRASSLTWVPCQMCGSQPSLSLAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLR
RMADDLNAQYERRRQEEQPQHRPSPWRVLYNLIMGLLPFPRGHRAPEMEPN
>gnl|bcl2dbpro|A0A2K6TBD7_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Saimiri boliviensis boliviensis GN=BIK (length=155 residues).
MSEDRPLSSDILMETLLCEQFVDPLTMEVVGGSDPEEDPDSVEDPLECMENSDALALQLACIADQMDVSLRARRLAQLYE
VATYSPGLAFILDRTDIRDVLSGVVDVFADFQEDIVRLWRSLSSGSWVSGKQAVLLALLALLLAMFSGGLRLLLK
>gnl|bcl2dbpro|A0A2K6TG62_BAD-02 BCL2-associated agonist of cell death protein OS=[Eukaryota] Saimiri boliviensis boliviensis GN=BAD (length=143 residues).
MFQIPEFEPSEQEDSSSAERGLSPSTAGDSPPGSGKHRRQAPGLPGDASHQQGQPTSSSHHGGTSSPEERGHSNADAAKL
QLDASHPVLVGSELGQGRLRSLPVTFAPHPETLPAPIALGGHLGHGRKCFLQGGLTQIPFRCV
>gnl|bcl2dbpro|A0A2K6TG62_BAD-03 BCL2-associated agonist of cell death protein OS=[Eukaryota] Saimiri boliviensis boliviensis GN=BAD (length=149 residues).
MFQIPEFEPSEQEDSSSAERGLSPSTAGDSPPGSGKHRRQAPGLPGDASHQQGQPTSSSHHGENPSAKMLSKASAGMSAP
ATDSEAQHTENVKLEALEPWRHGVATARTPQGRRGTKGWRRSPALFGAVRARHPPTSGQHSDMAASSGG
>gnl|bcl2dbpro|A0A2K6TG62_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Saimiri boliviensis boliviensis GN=BAD (length=167 residues).
MFQIPEFEPSEQEDSSSAERGLSPSTAGDSPPGSGKHRRQAPGLPGDASHQQGQPTSSSHHGGAGAVETRSRHSSYPAGT
EGDEGMEEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKGLPRPKSAGTATQMRQSSSWTRVIQSWWDRNLGR
GGSAPSQ
>gnl|bcl2dbpro|A0A2K6TRZ5_BCL2L11-10 BCL2-like 11 protein OS=[Eukaryota] Saimiri boliviensis boliviensis GN=BCL2L11 (length=112 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVVIRMDIGD
ISLWFRFIFTFFDLYGYHHSQGTEQLHHKYVS
>gnl|bcl2dbpro|A0A2K6TRZ5_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Saimiri boliviensis boliviensis GN=BCL2L11 (length=200 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFVRRSSVLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAEPAGMRPEIWIAQELRRIGDE
FNAYYPRRVFLNNYQAAEDHPHMVILRLLRYIVRLVWRMH
>gnl|bcl2dbpro|A0A2K6TRZ5_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Saimiri boliviensis boliviensis GN=BCL2L11 (length=135 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFVRRSSVLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMGIFE
>gnl|bcl2dbpro|A0A2K6TRZ5_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Saimiri boliviensis boliviensis GN=BCL2L11 (length=140 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAE
PAGMRPEIWIAQELRRIGDEFNAYYPRRVFLNNYQAAEDHPHMVILRLLRYIVRLVWRMH
>gnl|bcl2dbpro|A0A2K6TRZ5_BCL2L11-04 BCL2-like 11 protein OS=[Eukaryota] Saimiri boliviensis boliviensis GN=BCL2L11 (length=200 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFVRRSSVLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAEPAGMRPEIWIAQELRRIGDE
FNAYYPRRVFLNNYQAAEDHPHMVILRLLRYIVRLVWRMH
>gnl|bcl2dbpro|A0A2K6TRZ5_BCL2L11-05 BCL2-like 11 protein OS=[Eukaryota] Saimiri boliviensis boliviensis GN=BCL2L11 (length=174 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFVRRSSVLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAEPAGMRPEIWIAQELRRIGDE
FNAYYPRRISLPPD
>gnl|bcl2dbpro|A0A2K6TRZ5_BCL2L11-06 BCL2-like 11 protein OS=[Eukaryota] Saimiri boliviensis boliviensis GN=BCL2L11 (length=140 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFVRRSSVLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVREIEEVVV
>gnl|bcl2dbpro|A0A2K6TRZ5_BCL2L11-07 BCL2-like 11 protein OS=[Eukaryota] Saimiri boliviensis boliviensis GN=BCL2L11 (length=171 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFVRRSSVLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAEPAGMRPEIWIAQELRRIGDE
FNAYYPRRLEK
>gnl|bcl2dbpro|A0A2K6TRZ5_BCL2L11-08 BCL2-like 11 protein OS=[Eukaryota] Saimiri boliviensis boliviensis GN=BCL2L11 (length=135 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFVRRSSVLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMADWD
>gnl|bcl2dbpro|A0A2K6TRZ5_BCL2L11-09 BCL2-like 11 protein OS=[Eukaryota] Saimiri boliviensis boliviensis GN=BCL2L11 (length=96 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMDEATGSSLA
LRREVQCPLEWLAKSS
>gnl|bcl2dbpro|A0A2K6TW86_BMF-03 Bcl2 modifying factor protein OS=[Eukaryota] Saimiri boliviensis boliviensis GN=BMF (length=130 residues).
MEPSQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYAPAEPKSCVVAGPPLPAQPGFEWRRKQEWGRSE
>gnl|bcl2dbpro|A0A2K6TW86_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Saimiri boliviensis boliviensis GN=BMF (length=184 residues).
MEPSQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNRNRVW
WQVLLFLHNLALNGEENRNGAGPR
>gnl|bcl2dbpro|A0A2K6TW86_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Saimiri boliviensis boliviensis GN=BMF (length=184 residues).
MEPSQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNRNRVW
WQVLLFLHNLALNGEENRNGAGPR
© 1998-2018