Dataset for protein Bmf of organism Saimiri boliviensis boliviensis

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A2K6TW86_BMF-03 Bcl2 modifying factor protein OS=[Eukaryota] Saimiri boliviensis boliviensis GN=BMF (length=130 residues).
MEPSQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYAPAEPKSCVVAGPPLPAQPGFEWRRKQEWGRSE
>gnl|bcl2dbpro|A0A2K6TW86_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Saimiri boliviensis boliviensis GN=BMF (length=184 residues).
MEPSQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNRNRVW
WQVLLFLHNLALNGEENRNGAGPR
>gnl|bcl2dbpro|A0A2K6TW86_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Saimiri boliviensis boliviensis GN=BMF (length=184 residues).
MEPSQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNRNRVW
WQVLLFLHNLALNGEENRNGAGPR
© 1998-2018