Dataset for protein Bik of organism Saimiri boliviensis boliviensis

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A2K6TBD7_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Saimiri boliviensis boliviensis GN=BIK (length=155 residues).
MSEDRPLSSDILMETLLCEQFVDPLTMEVVGGSDPEEDPDSVEDPLECMENSDALALQLACIADQMDVSLRARRLAQLYE
VATYSPGLAFILDRTDIRDVLSGVVDVFADFQEDIVRLWRSLSSGSWVSGKQAVLLALLALLLAMFSGGLRLLLK
© 1998-2018