Dataset for protein Bad of organism Saimiri boliviensis boliviensis

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A2K6TG62_BAD-02 BCL2-associated agonist of cell death protein OS=[Eukaryota] Saimiri boliviensis boliviensis GN=BAD (length=143 residues).
MFQIPEFEPSEQEDSSSAERGLSPSTAGDSPPGSGKHRRQAPGLPGDASHQQGQPTSSSHHGGTSSPEERGHSNADAAKL
QLDASHPVLVGSELGQGRLRSLPVTFAPHPETLPAPIALGGHLGHGRKCFLQGGLTQIPFRCV
>gnl|bcl2dbpro|A0A2K6TG62_BAD-03 BCL2-associated agonist of cell death protein OS=[Eukaryota] Saimiri boliviensis boliviensis GN=BAD (length=149 residues).
MFQIPEFEPSEQEDSSSAERGLSPSTAGDSPPGSGKHRRQAPGLPGDASHQQGQPTSSSHHGENPSAKMLSKASAGMSAP
ATDSEAQHTENVKLEALEPWRHGVATARTPQGRRGTKGWRRSPALFGAVRARHPPTSGQHSDMAASSGG
>gnl|bcl2dbpro|A0A2K6TG62_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Saimiri boliviensis boliviensis GN=BAD (length=167 residues).
MFQIPEFEPSEQEDSSSAERGLSPSTAGDSPPGSGKHRRQAPGLPGDASHQQGQPTSSSHHGGAGAVETRSRHSSYPAGT
EGDEGMEEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKGLPRPKSAGTATQMRQSSSWTRVIQSWWDRNLGR
GGSAPSQ
© 1998-2018