Dataset for protein classical BH3-containing proteins of organism Rhinopithecus bieti

[Download (right click)] [Alignment] [Repertoires]

19 sequence(s)

>gnl|bcl2dbpro|A0A2K6KJF2_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Rhinopithecus bieti GN=PMAIP1 (length=54 residues).
MPGKKARKNAQPSPARAQAELEVECATQLRRFGDKLNFRQKLLNLIAKLFCSGT
>gnl|bcl2dbpro|A0A2K6KJF2_PMAIP1-02 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Rhinopithecus bieti GN=PMAIP1 (length=133 residues).
MPGKKARKNAQPSPARAQAGPAGTAGTARDQAGLGIGMQLHFTRGKKLLSSSPLALPRGHEEQVQVARSRVCYSTQEIWR
QTELPAETFESDSQTLLLRNLTASKTCIRGLQTRIFLRRCTFHQFEERLHCNW
>gnl|bcl2dbpro|A0A2K6KJP8_BCL2L11-09 BCL2-like 11 protein OS=[Eukaryota] Rhinopithecus bieti GN=BCL2L11 (length=135 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEDNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMANWD
>gnl|bcl2dbpro|A0A2K6KJP8_BCL2L11-10 BCL2-like 11 protein OS=[Eukaryota] Rhinopithecus bieti GN=BCL2L11 (length=117 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVVILEDIGD
TSLWFGFIFTGLDLYVVWIYIYHHSQDTEQLNHRDFS
>gnl|bcl2dbpro|A0A2K6KJP8_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Rhinopithecus bieti GN=BCL2L11 (length=198 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEDNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQELRRIGDEFN
AYYARRVFLNNYQAAEDHPQMVILRLLRYIVRLVWRMH
>gnl|bcl2dbpro|A0A2K6KJP8_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Rhinopithecus bieti GN=BCL2L11 (length=198 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEDNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQELRRIGDEFN
AYYARRVFLNNYQAAEDHPQMVILRLLRYIVRLVWRMH
>gnl|bcl2dbpro|A0A2K6KJP8_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Rhinopithecus bieti GN=BCL2L11 (length=138 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPA
DMRPEIRIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPQMVILRLLRYIVRLVWRMH
>gnl|bcl2dbpro|A0A2K6KJP8_BCL2L11-04 BCL2-like 11 protein OS=[Eukaryota] Rhinopithecus bieti GN=BCL2L11 (length=135 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEDNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMGIFE
>gnl|bcl2dbpro|A0A2K6KJP8_BCL2L11-05 BCL2-like 11 protein OS=[Eukaryota] Rhinopithecus bieti GN=BCL2L11 (length=172 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEDNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQELRRIGDEFN
AYYARRMSLPPD
>gnl|bcl2dbpro|A0A2K6KJP8_BCL2L11-06 BCL2-like 11 protein OS=[Eukaryota] Rhinopithecus bieti GN=BCL2L11 (length=140 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEDNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVREIEEVVV
>gnl|bcl2dbpro|A0A2K6KJP8_BCL2L11-07 BCL2-like 11 protein OS=[Eukaryota] Rhinopithecus bieti GN=BCL2L11 (length=169 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEDNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQELRRIGDEFN
AYYARRLEK
>gnl|bcl2dbpro|A0A2K6KJP8_BCL2L11-08 BCL2-like 11 protein OS=[Eukaryota] Rhinopithecus bieti GN=BCL2L11 (length=85 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQASRRQAEPADMRPEIRIAQELRRIGDEFNAYYARRLAKL
LASST
>gnl|bcl2dbpro|A0A2K6KS56_BBC3-02 BCL2 binding component 3 protein OS=[Eukaryota] Rhinopithecus bieti GN=BBC3 (length=86 residues).
LAERTWSRGASPGALAAPGVAGRRRSGPGIGAQLRRMARRLNAQYRRRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGHRA
PEMEPN
>gnl|bcl2dbpro|A0A2K6L933_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Rhinopithecus bieti GN=BMF (length=184 residues).
MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNRNRVW
WQILLFLHNLALNGEENRNGAGPR
>gnl|bcl2dbpro|A0A2K6L933_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Rhinopithecus bieti GN=BMF (length=204 residues).
MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNRNRVW
WQILLFLHNLALNGEENRNGAGPRPLTWNGGRCQTLLKGRLMCL
>gnl|bcl2dbpro|A0A2K6L933_BMF-03 Bcl2 modifying factor protein OS=[Eukaryota] Rhinopithecus bieti GN=BMF (length=184 residues).
MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNRNRVW
WQILLFLHNLALNGEENRNGAGPR
>gnl|bcl2dbpro|A0A2K6MCW0_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Rhinopithecus bieti GN=BIK (length=157 residues).
MSGVRPVSRDILMETLLYEQLLEPLTMEVLGVTDPEEDLDPMEDFDPLECMEDSDMLALRLACIGDEMDVSLRAPRLAQL
SEVAMHSLGLAFIYDQTDDIRDVLTSFMDGFTTLKENIMRFWRSLNPGSQVSREQVLLALLLLLAALLSGGLHLLLK
>gnl|bcl2dbpro|A0A2K6N1A1_BAD-02 BCL2-associated agonist of cell death protein OS=[Eukaryota] Rhinopithecus bieti GN=BAD (length=162 residues).
MFQIPEFEPSEQEDSSSAERGLGPSPAGDRPSDSGKHHRQAPGLLWDASHQQEQPTSSSHHGGRAWYYPAESEDSENPSA
RMLAEASAGMSAPATDSEAQLAENVKLEALGLWRPGVATAPTPRGRRRTKGWRRSPAPFGAARAPRPLTSGQHSDMAASS
GG
>gnl|bcl2dbpro|A0A2K6N1A1_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Rhinopithecus bieti GN=BAD (length=167 residues).
MFQIPEFEPSEQEDSSSAERGLGPSPAGDRPSDSGKHHRQAPGLLWDASHQQEQPTSSSHHGGAGAVETRSRHSSYPAGT
EEDEGMEEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGR
GSSAPSQ
© 1998-2018