Dataset for protein Bmf of organism Rhinopithecus bieti

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A2K6L933_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Rhinopithecus bieti GN=BMF (length=184 residues).
MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNRNRVW
WQILLFLHNLALNGEENRNGAGPR
>gnl|bcl2dbpro|A0A2K6L933_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Rhinopithecus bieti GN=BMF (length=204 residues).
MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNRNRVW
WQILLFLHNLALNGEENRNGAGPRPLTWNGGRCQTLLKGRLMCL
>gnl|bcl2dbpro|A0A2K6L933_BMF-03 Bcl2 modifying factor protein OS=[Eukaryota] Rhinopithecus bieti GN=BMF (length=184 residues).
MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNRNRVW
WQILLFLHNLALNGEENRNGAGPR
© 1998-2018