Dataset for protein Puma of organism Rhinopithecus bieti

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A2K6KS56_BBC3-02 BCL2 binding component 3 protein OS=[Eukaryota] Rhinopithecus bieti GN=BBC3 (length=86 residues).
LAERTWSRGASPGALAAPGVAGRRRSGPGIGAQLRRMARRLNAQYRRRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGHRA
PEMEPN
© 1998-2018