Dataset for protein Noxa of organism Rattus norvegicus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|Q5U777_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Rattus norvegicus GN=PMAIP1 (length=105 residues).
MPGRKARRNAPLNPTRAELPPEFAAQLRKIGDKVYCTWSAPDITAVLAQMPGKKSRKSTMRRSPSPTRVPADLKDECDQL
RRIGDKVNLRQKLLNFISKLFNLIT
© 1998-2018