Dataset for protein Hrk of organism Rattus norvegicus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|P62817_HRK-01 Harakiri, BCL2 interacting protein protein OS=[Eukaryota] Rattus norvegicus GN=HRK (length=92 residues).
MCPCPRHRGRGPPAVCGCGDARPGLRWAAAQVTALRLQALGDELHRRAMRRRARPRDPLPALLPALRARWPWLCAAAQVA
ALAAWLLGRRSA
© 1998-2018