Dataset for protein classical BH3-containing proteins of organism Rattus norvegicus

[Download (right click)] [Alignment] [Repertoires]

9 sequence(s)

>gnl|bcl2dbpro|O35147_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Rattus norvegicus GN=BAD (length=205 residues).
MGTPKQPSLAPAHALGLRKSDPGIRSLGSDAGGRRWRPAAQSMFQIPEFEPSEQEDASTTDRGLGPSLTEDQPGPYLAPG
LLGSIVQQQPGQAANNSHHGGAGTMETRSRHSSYPAGTEEDEGMEEELSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFE
GSFKGLPRPKSAGTATQMRQSASWTRIIQSWWDRNLGKGGSTPSQ
>gnl|bcl2dbpro|O88498_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Rattus norvegicus GN=BCL2L11 (length=196 residues).
MAKQPSDVNSECDREGGQLQPAERPPQLRPGAPTSLQTESQGNPDGEGDRCPHGSPQGPLAPPASPGPFATRSPLFIFVR
RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASIRQSQEEPEDLRPEIRIAQELRRIGDEFNET
YTRRAFANDYREAEDHPQMVILQLLRFIFRLVWRRH
>gnl|bcl2dbpro|O88498_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Rattus norvegicus GN=BCL2L11 (length=140 residues).
MAKQPSDVNSECDREGGQLQPAERPPQLRPGAPTSLQTESQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASIRQSQEE
PEDLRPEIRIAQELRRIGDEFNETYTRRAFANDYREAEDHPQMVILQLLRFIFRLVWRRH
>gnl|bcl2dbpro|P62817_HRK-01 Harakiri, BCL2 interacting protein protein OS=[Eukaryota] Rattus norvegicus GN=HRK (length=92 residues).
MCPCPRHRGRGPPAVCGCGDARPGLRWAAAQVTALRLQALGDELHRRAMRRRARPRDPLPALLPALRARWPWLCAAAQVA
ALAAWLLGRRSA
>gnl|bcl2dbpro|Q5U777_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Rattus norvegicus GN=PMAIP1 (length=105 residues).
MPGRKARRNAPLNPTRAELPPEFAAQLRKIGDKVYCTWSAPDITAVLAQMPGKKSRKSTMRRSPSPTRVPADLKDECDQL
RRIGDKVNLRQKLLNFISKLFNLIT
>gnl|bcl2dbpro|Q6P7C5_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Rattus norvegicus GN=BAD (length=114 residues).
MGTPKQPSLAPAHALGLRKSDPGIRSLGSDAGGRRWRPAAQSMFQIPEFEPSEQEDASTTDRGLGPSLTEDQPGPYLAPG
LLGSIVQQQPGQAANNSHHGGRFLTSIIFLSHVP
>gnl|bcl2dbpro|Q80ZG6_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Rattus norvegicus GN=BBC3 (length=193 residues).
MARARQEGSSPEPVEGLARDSPRPFPLGRLMPSAVSCGLCEPGLPAAPAAPALLPAAYLCAPTAPPAVTAALGGPRWPGG
HRSRPRGPRPDGPQPSLSPAQQHLESPVPSAPEALAGGPTQAAPGVRVEEEEWAREIGAQLRRMADDLNAQYERRRQEEQ
HRHRPSPWRVMYNLFMGLLPLPRDPGAPEMEPN
>gnl|bcl2dbpro|Q8K589_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Rattus norvegicus GN=BMF (length=185 residues).
MEPPQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPVSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGSALGEQPPEGQFLQHRAEVQIARKLQCIADQFHRLHMQQHQQNRDRA
WRQVFLFLQNLALNRRENREGVGPW
>gnl|bcl2dbpro|Q925D2_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Rattus norvegicus GN=BIK (length=158 residues).
MSEARLMARDIIKTLLHDQVPQPAVVSGAPSMKEPVGVEDVSPVRDLDFMRCLESRNQVALRLACIGDEMDRCLRSPRLV
QLPGIAMHRLAATYSQTGVRGIFRSLIGSLTNLRENIWSWRVFTPGAWVSPDQDPGQLFPMVLLVFLLLGGAWHLQLQ
© 1998-2018