Dataset for protein Bmf of organism Rattus norvegicus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|Q8K589_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Rattus norvegicus GN=BMF (length=185 residues).
MEPPQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPVSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGSALGEQPPEGQFLQHRAEVQIARKLQCIADQFHRLHMQQHQQNRDRA
WRQVFLFLQNLALNRRENREGVGPW
© 1998-2018