Dataset for protein Bad of organism Rattus norvegicus

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|O35147_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Rattus norvegicus GN=BAD (length=205 residues).
MGTPKQPSLAPAHALGLRKSDPGIRSLGSDAGGRRWRPAAQSMFQIPEFEPSEQEDASTTDRGLGPSLTEDQPGPYLAPG
LLGSIVQQQPGQAANNSHHGGAGTMETRSRHSSYPAGTEEDEGMEEELSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFE
GSFKGLPRPKSAGTATQMRQSASWTRIIQSWWDRNLGKGGSTPSQ
>gnl|bcl2dbpro|Q6P7C5_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Rattus norvegicus GN=BAD (length=114 residues).
MGTPKQPSLAPAHALGLRKSDPGIRSLGSDAGGRRWRPAAQSMFQIPEFEPSEQEDASTTDRGLGPSLTEDQPGPYLAPG
LLGSIVQQQPGQAANNSHHGGRFLTSIIFLSHVP
© 1998-2018