Dataset for protein Unclassified of organism Pygocentrus nattereri

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A3B4DQ45_uncBBC3-01 Putative BCL2 binding component 3 protein OS=[Eukaryota] Pygocentrus nattereri (length=186 residues).
MARPQMDSRVDSQSPTAPQSCRMEVLRRDAWPSGGTHSASQARHRHRTMATQTSPVLLSHARTQDAASLPNTNQQDGPLR
DNTGTEPERSSSAETQQPLHDLTAESHSSSADSSRRESPAEEEPTPEEQAIHRVAIQLRTIGDDMNAVYLQRRNEAPQWQ
NWRGLYRGLVAFLADTISTLYQHGVR
© 1998-2019