Dataset for protein classical BH3-containing proteins of organism Pygocentrus nattereri

[Download (right click)] [Alignment] [Repertoires]

6 sequence(s)

>gnl|bcl2dbpro|A0A3B4BVX1_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Pygocentrus nattereri GN=BCL2L11 (length=219 residues).
LLSARKARFSVCPCSSPEDRIHHLPHYLRSNRAGRPAFLKEQGESGQSSGAASSRAAEQCEQPEPGEGDPVRGGITMPNS
LLGYQSRSPLFRTLSRSSSGYFSFESEPSSPLVTHSASTQTPSPSSQVITHALQRIAEARGNAQTFELWPLYNHHPPHGA
APAGDMRPESYVAQELRRIGDEFNELYFHGVSQLHGCVAGMQALSNPVAFSILGLFRGH
>gnl|bcl2dbpro|A0A3B4BVX1_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Pygocentrus nattereri GN=BCL2L11 (length=163 residues).
MQNSNYCCFEQGESGQSSGAASSRAAEQCEQPEPGEGDPVRGGITMPNSLLGYQSRSPLFRTLSRSSSGYFSFESEPSSP
LLTSPSLSVCSTELWPLYNHHPPHGAAPAGDMRPESYVAQELRRIGDEFNELYFHGVSQLHGCVAGMQALSARDLHDQMF
ALS
>gnl|bcl2dbpro|A0A3B4BVX1_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Pygocentrus nattereri GN=BCL2L11 (length=202 residues).
MSRRSNRAGRPAFLKEQGESGQSSGAASSRAAEQCEQPEPGEGDPVRGGITMPNSLLGYQSRSPLFRTLSRSSSGYFSFE
SEPSSPLVTHSASTQTPSPSSQVITHALQRIAEARGNAQTFELWPLYNHHPPHGAAPAGDMRPESYVAQELRRIGDEFNE
LYFHGAGRNGGRVQLPAEEEPAFMLWLGLVIRRLLEVLLRRR
>gnl|bcl2dbpro|A0A3B4CNJ8_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Pygocentrus nattereri GN=BMF (length=155 residues).
MDEDEDDVFVMDTQYWRSSIREIKQEERGTQTPGRPPARPNGMLPCGVSEEPRRLFYGSAGLLLLAPSVRPEHVEGAMLQ
EDQLAMEPRRRPPHSVEARIGQKLQMIGDQFYQEHMLQHRNQRNQQPFWLRLASALYTLLFEREPVANGRRVDQR
>gnl|bcl2dbpro|A0A3B4CPH6_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Pygocentrus nattereri GN=BAD (length=158 residues).
MAHMFTLSDDSDTSEDLGDADQPEASKRAELSQSGQHPLVPERFRESRQRNHSMNEDALQESGAVRHGDGAADGDSFRRR
CRSAPPALWAAKKYGRQLRKMSDEFDTLLDKGMKRVRSAGAARQMHASPSWFTFLWSHKESDSEASSSLTAPDTRPAE
>gnl|bcl2dbpro|A0A3B4DUY7_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Pygocentrus nattereri GN=BAD (length=206 residues).
MSNQYLQKLRRARFNCEEERYKKVIKTLTGEKGTPFNPLCWNSLRTTACAMEKHSEDGISTMDDQDESNWSETVKNGDSP
QLDSQHSMASNISPASPDELSEVGCRVRLYSESQVYTVSRWQDNEDGLLAEDGGAGDGAPFRGRSQSAPAALWKAKKYGR
QLRRMSDEFDTWLDKGDTRRASSPGKQTNRGWFSFLWGSKEEEGRE
© 1998-2019