Dataset for protein Bim of organism Pygocentrus nattereri

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A3B4BVX1_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Pygocentrus nattereri GN=BCL2L11 (length=219 residues).
LLSARKARFSVCPCSSPEDRIHHLPHYLRSNRAGRPAFLKEQGESGQSSGAASSRAAEQCEQPEPGEGDPVRGGITMPNS
LLGYQSRSPLFRTLSRSSSGYFSFESEPSSPLVTHSASTQTPSPSSQVITHALQRIAEARGNAQTFELWPLYNHHPPHGA
APAGDMRPESYVAQELRRIGDEFNELYFHGVSQLHGCVAGMQALSNPVAFSILGLFRGH
>gnl|bcl2dbpro|A0A3B4BVX1_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Pygocentrus nattereri GN=BCL2L11 (length=163 residues).
MQNSNYCCFEQGESGQSSGAASSRAAEQCEQPEPGEGDPVRGGITMPNSLLGYQSRSPLFRTLSRSSSGYFSFESEPSSP
LLTSPSLSVCSTELWPLYNHHPPHGAAPAGDMRPESYVAQELRRIGDEFNELYFHGVSQLHGCVAGMQALSARDLHDQMF
ALS
>gnl|bcl2dbpro|A0A3B4BVX1_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Pygocentrus nattereri GN=BCL2L11 (length=202 residues).
MSRRSNRAGRPAFLKEQGESGQSSGAASSRAAEQCEQPEPGEGDPVRGGITMPNSLLGYQSRSPLFRTLSRSSSGYFSFE
SEPSSPLVTHSASTQTPSPSSQVITHALQRIAEARGNAQTFELWPLYNHHPPHGAAPAGDMRPESYVAQELRRIGDEFNE
LYFHGAGRNGGRVQLPAEEEPAFMLWLGLVIRRLLEVLLRRR
© 1998-2019