Dataset for protein Bad of organism Pygocentrus nattereri

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A3B4CPH6_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Pygocentrus nattereri GN=BAD (length=158 residues).
MAHMFTLSDDSDTSEDLGDADQPEASKRAELSQSGQHPLVPERFRESRQRNHSMNEDALQESGAVRHGDGAADGDSFRRR
CRSAPPALWAAKKYGRQLRKMSDEFDTLLDKGMKRVRSAGAARQMHASPSWFTFLWSHKESDSEASSSLTAPDTRPAE
>gnl|bcl2dbpro|A0A3B4DUY7_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Pygocentrus nattereri GN=BAD (length=206 residues).
MSNQYLQKLRRARFNCEEERYKKVIKTLTGEKGTPFNPLCWNSLRTTACAMEKHSEDGISTMDDQDESNWSETVKNGDSP
QLDSQHSMASNISPASPDELSEVGCRVRLYSESQVYTVSRWQDNEDGLLAEDGGAGDGAPFRGRSQSAPAALWKAKKYGR
QLRRMSDEFDTWLDKGDTRRASSPGKQTNRGWFSFLWGSKEEEGRE
© 1998-2019