Dataset for protein classical BH3-containing proteins of organism Pundamilia nyererei

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A3B4ETH0_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Pundamilia nyererei GN=BMF (length=163 residues).
MDDEEDDVFEPKANCWRTTFREIKCEHRGTQTPGPALVPNNGMLPCGVAEEPRPLFYGNAGFRLHFPARFELVGDHRASR
QGSTEQQNSMERLPRQRPAARSVEACIGQKLQLIGDQFHWERLQLYHRNQRNQGPMWWRLAAAILSLLFDRGFIAGGGGG
GRR
>gnl|bcl2dbpro|A0A3B4GXJ6_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Pundamilia nyererei GN=BAD (length=158 residues).
MAANFKISDSDSEASEEVGEGENQQSAGQAQESKPQTLSLPVIKTTAAGRLRVNSESHTSSIARDEELMARGEDEVCTPT
EGDPFRRRSKSAPPALWAAKKYGRQLRRMSDEFDSLLDKGEMKVKKLHHSKTWWSYLFSHQETEGENNHLENHNQRTE
© 1998-2019