Dataset for protein classical BH3-containing proteins of organism Propithecus coquereli

[Download (right click)] [Alignment] [Repertoires]

14 sequence(s)

>gnl|bcl2dbpro|A0A2K6EM90_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Propithecus coquereli GN=PMAIP1 (length=54 residues).
MPVKKARKNAQPSPTRTRAEIEEECALQLRRLGDKLHFQQKLLNLIAKLFRSGT
>gnl|bcl2dbpro|A0A2K6FFR1_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Propithecus coquereli GN=BMF (length=130 residues).
MEPSHCVEELEDDVFQPEDGESGTQPGSVLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYAPAEPKSHVVADPPLPTQPCFERRREQERGRSQ
>gnl|bcl2dbpro|A0A2K6FFR1_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Propithecus coquereli GN=BMF (length=184 residues).
MEPSHCVEELEDDVFQPEDGESGTQPGSVLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPAEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNQNRMW
WQILLFLHNLALNGEENRNGAGPR
>gnl|bcl2dbpro|A0A2K6FM79_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Propithecus coquereli GN=BIK (length=152 residues).
MSEVRPVSTDLLMETFPFEHLLDPLILEVLSIMDNEENPDPSGCLEDSDEVALRLACIGDEMDLCLRSPRLAWLPGMTMH
SLGLALSCDQPVRWGVLGSLSDGFANLREYVARLWRSLSPRPWVCPAPAWEQVLLLLLVLLLLGGGLHLLLK
>gnl|bcl2dbpro|A0A2K6FQZ3_BBC3-04 BCL2 binding component 3 protein OS=[Eukaryota] Propithecus coquereli GN=BBC3 (length=131 residues).
MKFGAGSARACPCQVPGTSFSWWVLGHIPGPQPSLSLAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLR
RMADDLNAQYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN
>gnl|bcl2dbpro|A0A2K6FQZ3_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Propithecus coquereli GN=BBC3 (length=193 residues).
MARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGLCEPGLPAAPAAPALLPAAYLCAPTAPPAVTAALGGPRWPGG
PRSRPRGPRPDGPQPSLSLAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNAQYERRRQEEQ
QRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN
>gnl|bcl2dbpro|A0A2K6GE31_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Propithecus coquereli GN=BCL2L11 (length=200 residues).
MAKQPSDVGSECDREGGQLQSVERPPQLRPGAPTSLQTEPQGNPEGSREGEGDRCSHGSPQGPLAPPASPGPFATRSPLF
IFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQFQAEPADMRPEIWIAQELRRIGDE
FNAYYPRRVFLNNYQADEDHPQMLILRLLRYIVRLVWRRH
>gnl|bcl2dbpro|A0A2K6GE31_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Propithecus coquereli GN=BCL2L11 (length=140 residues).
MAKQPSDVGSECDREGGQLQSVERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQFQAE
PADMRPEIWIAQELRRIGDEFNAYYPRRVFLNNYQADEDHPQMLILRLLRYIVRLVWRRH
>gnl|bcl2dbpro|A0A2K6GE31_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Propithecus coquereli GN=BCL2L11 (length=135 residues).
MAKQPSDVGSECDREGGQLQSVERPPQLRPGAPTSLQTEPQGNPEGSREGEGDRCSHGSPQGPLAPPASPGPFATRSPLF
IFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMGIFE
>gnl|bcl2dbpro|A0A2K6GE31_BCL2L11-04 BCL2-like 11 protein OS=[Eukaryota] Propithecus coquereli GN=BCL2L11 (length=174 residues).
MAKQPSDVGSECDREGGQLQSVERPPQLRPGAPTSLQTEPQGNPEGSREGEGDRCSHGSPQGPLAPPASPGPFATRSPLF
IFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQFQAEPADMRPEIWIAQELRRIGDE
FNAYYPRRMPLPSD
>gnl|bcl2dbpro|A0A2K6GE31_BCL2L11-05 BCL2-like 11 protein OS=[Eukaryota] Propithecus coquereli GN=BCL2L11 (length=140 residues).
MAKQPSDVGSECDREGGQLQSVERPPQLRPGAPTSLQTEPQGNPEGSREGEGDRCSHGSPQGPLAPPASPGPFATRSPLF
IFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVREIEEVVV
>gnl|bcl2dbpro|A0A2K6GE31_BCL2L11-06 BCL2-like 11 protein OS=[Eukaryota] Propithecus coquereli GN=BCL2L11 (length=87 residues).
MAKQPSDVGSECDREGGQLQSVERPPQLRPGAPTSLQTEPQASMRQFQAEPADMRPEIWIAQELRRIGDEFNAYYPRRLA
KCLVPSI
>gnl|bcl2dbpro|A0A2K6GL98_HRK-01 Harakiri, BCL2 interacting protein protein OS=[Eukaryota] Propithecus coquereli GN=HRK (length=91 residues).
MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAARLKALGDELHQRTMWRRRARSRRAPAPGALTTYWPWLCAAAQVAA
LAAWLLGRRNL
>gnl|bcl2dbpro|A0A2K6GWV0_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Propithecus coquereli GN=BAD (length=168 residues).
MFQIPEFEPSEQEDSSSAGRGLGPSPSGDRPSGPGKHPCTAPSFLGDASHQQGQPSSSSHHGGAGSVETRSRHSSYPAGT
EEDEGMEEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEDSFKKGLPRPKSAGTATQIRQSSSWTRVIQSWWDRNVG
RGGSAPSQ
© 1998-2018