Dataset for protein Bik of organism Propithecus coquereli

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A2K6FM79_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Propithecus coquereli GN=BIK (length=152 residues).
MSEVRPVSTDLLMETFPFEHLLDPLILEVLSIMDNEENPDPSGCLEDSDEVALRLACIGDEMDLCLRSPRLAWLPGMTMH
SLGLALSCDQPVRWGVLGSLSDGFANLREYVARLWRSLSPRPWVCPAPAWEQVLLLLLVLLLLGGGLHLLLK
© 1998-2018