Dataset for protein Puma of organism Propithecus coquereli

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A2K6FQZ3_BBC3-04 BCL2 binding component 3 protein OS=[Eukaryota] Propithecus coquereli GN=BBC3 (length=131 residues).
MKFGAGSARACPCQVPGTSFSWWVLGHIPGPQPSLSLAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLR
RMADDLNAQYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN
>gnl|bcl2dbpro|A0A2K6FQZ3_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Propithecus coquereli GN=BBC3 (length=193 residues).
MARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGLCEPGLPAAPAAPALLPAAYLCAPTAPPAVTAALGGPRWPGG
PRSRPRGPRPDGPQPSLSLAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNAQYERRRQEEQ
QRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN
© 1998-2018