Dataset for protein Bad of organism Propithecus coquereli

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A2K6GWV0_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Propithecus coquereli GN=BAD (length=168 residues).
MFQIPEFEPSEQEDSSSAGRGLGPSPSGDRPSGPGKHPCTAPSFLGDASHQQGQPSSSSHHGGAGSVETRSRHSSYPAGT
EEDEGMEEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEDSFKKGLPRPKSAGTATQIRQSSSWTRVIQSWWDRNVG
RGGSAPSQ
© 1998-2018