Dataset for protein Noxa of organism Pongo abelii

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|H2NWG2_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Pongo abelii GN=PMAIP1 (length=54 residues).
MPGKKARKNAQPSPARAPAELEVECATQLRRFGDKLNFRQKLLNLISKLFCSGT
© 1998-2018