Dataset for protein classical BH3-containing proteins of organism Pongo abelii

[Download (right click)] [Alignment] [Repertoires]

7 sequence(s)

>gnl|bcl2dbpro|A0A2J8T301_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Pongo abelii GN=BMF (length=184 residues).
MEPSQCVEELEDDVFQPEDGEPGTQSGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPTGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNRNRVW
WQILLFLHNLALNGEENRNGAGPR
>gnl|bcl2dbpro|A0A2J8TYJ3_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Pongo abelii GN=BAD (length=168 residues).
MFQIPEFEPSEQEDSSSAERGLGPSPAGDRPSGSSKHHRQAPGLLRDASHQQEQPTSSSHHGGAGAVEIRSRHSSYPAGT
EDDEGMGEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLG
RGSSAPSQ
>gnl|bcl2dbpro|H2NIS8_HRK-01 Harakiri, BCL2 interacting protein protein OS=[Eukaryota] Pongo abelii GN=HRK (length=91 residues).
MCPCPLHRDRGPPAVCACSAGRLGLRSSAAQLTAARLKALGDELHQRTMWRRRARSRRAPAPSALPTYWPWLCAAAQVAA
LAAWLLGRRNL
>gnl|bcl2dbpro|H2NWG2_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Pongo abelii GN=PMAIP1 (length=54 residues).
MPGKKARKNAQPSPARAPAELEVECATQLRRFGDKLNFRQKLLNLISKLFCSGT
>gnl|bcl2dbpro|H2NZD3_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Pongo abelii GN=BBC3 (length=193 residues).
MARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGLCEPGLAAAPAAPALLPAAYLCAPTAPPAVTAALGGPRWPGG
PRSRPRGPRPDGPQPSLSLAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNAQYERRRQEEQ
QRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN
>gnl|bcl2dbpro|H2P4N6_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Pongo abelii GN=BIK (length=125 residues).
MSEVRPISRDILMETLLYEQLLEPPTMEVLGVTDSEEDLDPMEDFSPLECMEGSDALALRLACIGDEMDVSLRAPRRAQL
PEVAMHSLGLAFIYDQTEDIRDVLRSFTDGFTTLKENIMRFWSSL
>gnl|bcl2dbpro|H2P5E2_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Pongo abelii GN=BCL2L11 (length=138 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPA
DMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH
© 1998-2018