Dataset for protein Bmf of organism Pongo abelii

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A2J8T301_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Pongo abelii GN=BMF (length=184 residues).
MEPSQCVEELEDDVFQPEDGEPGTQSGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPTGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNRNRVW
WQILLFLHNLALNGEENRNGAGPR
© 1998-2018