Dataset for protein Bik of organism Pongo abelii

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|H2P4N6_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Pongo abelii GN=BIK (length=125 residues).
MSEVRPISRDILMETLLYEQLLEPPTMEVLGVTDSEEDLDPMEDFSPLECMEGSDALALRLACIGDEMDVSLRAPRRAQL
PEVAMHSLGLAFIYDQTEDIRDVLRSFTDGFTTLKENIMRFWSSL
© 1998-2018