Dataset for protein Bim of organism Pongo abelii

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|H2P5E2_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Pongo abelii GN=BCL2L11 (length=138 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPA
DMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH
© 1998-2018