Dataset for protein Puma of organism Pongo abelii

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|H2NZD3_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Pongo abelii GN=BBC3 (length=193 residues).
MARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGLCEPGLAAAPAAPALLPAAYLCAPTAPPAVTAALGGPRWPGG
PRSRPRGPRPDGPQPSLSLAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNAQYERRRQEEQ
QRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN
© 1998-2018