Dataset for protein Bad of organism Pongo abelii

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A2J8TYJ3_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Pongo abelii GN=BAD (length=168 residues).
MFQIPEFEPSEQEDSSSAERGLGPSPAGDRPSGSSKHHRQAPGLLRDASHQQEQPTSSSHHGGAGAVEIRSRHSSYPAGT
EDDEGMGEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLG
RGSSAPSQ
© 1998-2018