Dataset for protein classical BH3-containing proteins of organism Poecilia reticulata

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A3P9N073_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Poecilia reticulata GN=BCL2L11 (length=202 residues).
DPASSARTPRSSKHTERSCAPQAGASTAGGGGGGGRGEPDSDSPPCTVSPASLDVFRSRSIFRPPRRSSSGYFSFDCDSL
PSSPLSPHPVTADKTTQTPSPTGQVMNHALQRMAVEHEIPKLNVKGKEEKGGRGGAFVIIPKRETNQPILSCVLPVQLMI
QQFSHATSIGIKKRKRVGYDDDYYHYYIDCFFLKSVSKYDVA
>gnl|bcl2dbpro|A0A3P9Q7C3_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Poecilia reticulata GN=BAD (length=166 residues).
MDAKFTISDSDSEPSEDVEERGNLQLMQVKERPLSQRHTLTLPELRSTTGRVRLNSESIASTISREEELQARGEEEVGTP
TEGFPFRVRSNSAPPSLWAAKKYGRQLRRMSDEFVNLLDKGEMRKVSSAGSNGPIHHSRSWWSYLFSHQETEGENNHHEN
HASRTE
>gnl|bcl2dbpro|A0A3P9Q8E2_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Poecilia reticulata GN=BMF (length=160 residues).
MEDEEDDVFEPDPNCWRTPFREIKCEDRGTQTPGPGQALHNGMLPCGVAEEPRRLFYGNAGFRLHFPAHFELVRDFDARQ
QEEQNRMEQLPLHQPAALSLEACIGQKLQLIGDQFHREHLQQYQQNQRNQGPLWWRMTAALLSLLFDRGFIAGGGGAGRR
© 1998-2019