Dataset for protein Bmf of organism Poecilia reticulata

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A3P9Q8E2_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Poecilia reticulata GN=BMF (length=160 residues).
MEDEEDDVFEPDPNCWRTPFREIKCEDRGTQTPGPGQALHNGMLPCGVAEEPRRLFYGNAGFRLHFPAHFELVRDFDARQ
QEEQNRMEQLPLHQPAALSLEACIGQKLQLIGDQFHREHLQQYQQNQRNQGPLWWRMTAALLSLLFDRGFIAGGGGAGRR
© 1998-2019