Dataset for protein classical BH3-containing proteins of organism Poecilia mexicana

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|A0A3B3WU80_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Poecilia mexicana GN=BMF (length=160 residues).
MEDEEDDVFEPDPNCWRTPFREIKCEDRGTQTPGPGQALHNGMLPCGVAEEPRRLFYGNAGFRLHFPAHFELVGDFDARQ
QEEQNRMEQLPLHQPAALSLEACIGQKLQLIGDQFHREHLQQYQQNQRNQGPLWWRMTAALLSLLFHRGFIAGGGGAGRR
>gnl|bcl2dbpro|A0A3B3YFR1_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Poecilia mexicana GN=BAD (length=166 residues).
MDAKFTISDSDSEPSEDVEERGNLQLMQVKERPLSQRHTLTLPELRSTTGRVRLNSESIASTISREEELQARGEEEVGTP
TEGFPFRGRSNSAPPSLWAAKKYGRQLRRMSDEFVNLLDKGEMRKVSSTGSNRPIHHSRSWWSYLFSHQETEGENNHHEN
HASRTE
>gnl|bcl2dbpro|A0A3B3YII5_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Poecilia mexicana GN=BCL2L11 (length=241 residues).
MHSLRPPNLLDGSTEVTPAEGTGGDPASSARTPRSSKHTERSCAPQAGASTAGGGGGGGGGGRGEPDSDSPPCSVSPASL
DVFRSRSIFRPPRRSSSGYFSFDCDSLPSSPLSPHPVTADKATQTPSPTGQVMNHALQRMAVEHGGLGLHGHSPNHYSTI
NAARDMQSENFGRQLRAIGDDYNNHLMRMARRHQRNIVPLNLMPHIQQEPVAMLCVCLLLLLVGRIMYMQGNTSSHDHSQ
V
>gnl|bcl2dbpro|A0A3B3YII5_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Poecilia mexicana GN=BCL2L11 (length=241 residues).
MHSLRPPNLLDGSTEVTPAEGTGGDPASSARTPRSSKHTERSCAPQAGASTAGGGGGGGGGGRGEPDSDSPPCSVSPASL
DVFRSRSIFRPPRRSSSGYFSFDCDSLPSSPLSPHPVTADKATQTPSPTGQVMNHALQRMAVEHGGLGLHGHSPNHYSTI
NAARDMQSENFGRQLRAIGDDYNNHLMRMARRHQRNIVPLNLMPHIQQEPVAMLCVCLLLLLVGRIMYMQGNTSSHDHSQ
V
© 1998-2019