Dataset for protein Bmf of organism Poecilia mexicana

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A3B3WU80_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Poecilia mexicana GN=BMF (length=160 residues).
MEDEEDDVFEPDPNCWRTPFREIKCEDRGTQTPGPGQALHNGMLPCGVAEEPRRLFYGNAGFRLHFPAHFELVGDFDARQ
QEEQNRMEQLPLHQPAALSLEACIGQKLQLIGDQFHREHLQQYQQNQRNQGPLWWRMTAALLSLLFHRGFIAGGGGAGRR
© 1998-2019